Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for lockert 211. lockert Lv 1 1 pt. 6,260
  2. Avatar for stephany44095 212. stephany44095 Lv 1 1 pt. 6,257
  3. Avatar for dradoff 213. dradoff Lv 1 1 pt. 6,193
  4. Avatar for kacperwszolek 214. kacperwszolek Lv 1 1 pt. 6,120
  5. Avatar for pandapharmd 215. pandapharmd Lv 1 1 pt. 6,092
  6. Avatar for Max2000 216. Max2000 Lv 1 1 pt. 6,091
  7. Avatar for Close At Hand 217. Close At Hand Lv 1 1 pt. 6,079
  8. Avatar for MaartenDesnouck 218. MaartenDesnouck Lv 1 1 pt. 6,078
  9. Avatar for cifa03 219. cifa03 Lv 1 1 pt. 6,076
  10. Avatar for warv 220. warv Lv 1 1 pt. 5,996

Comments