Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for bendbob 71. bendbob Lv 1 18 pts. 8,760
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 17 pts. 8,752
  3. Avatar for sheerbliss 73. sheerbliss Lv 1 17 pts. 8,741
  4. Avatar for drumpeter18yrs9yrs 74. drumpeter18yrs9yrs Lv 1 16 pts. 8,737
  5. Avatar for joremen 75. joremen Lv 1 16 pts. 8,732
  6. Avatar for tarquilu 76. tarquilu Lv 1 15 pts. 8,724
  7. Avatar for Graham MF 77. Graham MF Lv 1 15 pts. 8,719
  8. Avatar for hada 78. hada Lv 1 15 pts. 8,708
  9. Avatar for alwen 79. alwen Lv 1 14 pts. 8,706
  10. Avatar for Vinara 80. Vinara Lv 1 14 pts. 8,702

Comments