Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for lamoille 11. lamoille Lv 1 24 pts. 9,307
  2. Avatar for jamiexq 12. jamiexq Lv 1 21 pts. 9,305
  3. Avatar for MaartenDesnouck 13. MaartenDesnouck Lv 1 17 pts. 9,303
  4. Avatar for phi16 14. phi16 Lv 1 15 pts. 9,302
  5. Avatar for nemo7731 15. nemo7731 Lv 1 12 pts. 9,301
  6. Avatar for alwen 16. alwen Lv 1 10 pts. 9,300
  7. Avatar for smilingone 17. smilingone Lv 1 8 pts. 9,221
  8. Avatar for LociOiling 18. LociOiling Lv 1 7 pts. 9,219
  9. Avatar for reefyrob 19. reefyrob Lv 1 6 pts. 9,213
  10. Avatar for bertro 20. bertro Lv 1 4 pts. 9,211

Comments