Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for deLaCeiba 91. deLaCeiba Lv 1 10 pts. 8,631
  2. Avatar for harvardman 92. harvardman Lv 1 9 pts. 8,626
  3. Avatar for Schnurri 93. Schnurri Lv 1 9 pts. 8,626
  4. Avatar for caglar 94. caglar Lv 1 9 pts. 8,610
  5. Avatar for YGK 95. YGK Lv 1 8 pts. 8,591
  6. Avatar for Psych0Active 96. Psych0Active Lv 1 8 pts. 8,585
  7. Avatar for Superphosphate 97. Superphosphate Lv 1 8 pts. 8,575
  8. Avatar for Crossed Sticks 98. Crossed Sticks Lv 1 8 pts. 8,570
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 7 pts. 8,565
  10. Avatar for tallguy-13088 100. tallguy-13088 Lv 1 7 pts. 8,562

Comments