Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for GoodGuyGreg 131. GoodGuyGreg Lv 1 2 pts. 8,188
  2. Avatar for lange 132. lange Lv 1 2 pts. 8,161
  3. Avatar for arortiz73 133. arortiz73 Lv 1 2 pts. 8,138
  4. Avatar for Iron pet 134. Iron pet Lv 1 2 pts. 8,133
  5. Avatar for ragadhousni 135. ragadhousni Lv 1 2 pts. 8,127
  6. Avatar for bwkittitas 136. bwkittitas Lv 1 2 pts. 8,085
  7. Avatar for Jajaboman 137. Jajaboman Lv 1 2 pts. 8,057
  8. Avatar for Dantoto 138. Dantoto Lv 1 2 pts. 8,041
  9. Avatar for TheStaticSloth 139. TheStaticSloth Lv 1 2 pts. 8,020
  10. Avatar for parsnip 140. parsnip Lv 1 2 pts. 7,981

Comments