Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for bendbob 71. bendbob Lv 1 18 pts. 8,760
  2. Avatar for hansvandenhof 72. hansvandenhof Lv 1 17 pts. 8,752
  3. Avatar for sheerbliss 73. sheerbliss Lv 1 17 pts. 8,741
  4. Avatar for drumpeter18yrs9yrs 74. drumpeter18yrs9yrs Lv 1 16 pts. 8,737
  5. Avatar for joremen 75. joremen Lv 1 16 pts. 8,732
  6. Avatar for tarquilu 76. tarquilu Lv 1 15 pts. 8,724
  7. Avatar for Graham MF 77. Graham MF Lv 1 15 pts. 8,719
  8. Avatar for hada 78. hada Lv 1 15 pts. 8,708
  9. Avatar for alwen 79. alwen Lv 1 14 pts. 8,706
  10. Avatar for Vinara 80. Vinara Lv 1 14 pts. 8,702

Comments