Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for Scopper
    1. Scopper Lv 1
    100 pts. 9,395
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 86 pts. 9,390
  3. Avatar for pauldunn 3. pauldunn Lv 1 74 pts. 9,387
  4. Avatar for gloverd 4. gloverd Lv 1 63 pts. 9,379
  5. Avatar for penteplayer 5. penteplayer Lv 1 53 pts. 9,370
  6. Avatar for gitwut 6. gitwut Lv 1 44 pts. 9,355
  7. Avatar for Galaxie 7. Galaxie Lv 1 37 pts. 9,353
  8. Avatar for smilingone 8. smilingone Lv 1 31 pts. 9,351
  9. Avatar for Bletchley Park 9. Bletchley Park Lv 1 25 pts. 9,351
  10. Avatar for LociOiling 10. LociOiling Lv 1 21 pts. 9,351

Comments