Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for phi16 11. phi16 Lv 1 17 pts. 9,349
  2. Avatar for MaartenDesnouck 12. MaartenDesnouck Lv 1 14 pts. 9,349
  3. Avatar for gmn 13. gmn Lv 1 11 pts. 9,349
  4. Avatar for reefyrob 14. reefyrob Lv 1 9 pts. 9,347
  5. Avatar for Deleted player 15. Deleted player pts. 9,342
  6. Avatar for brgreening 16. brgreening Lv 1 5 pts. 9,338
  7. Avatar for lamoille 17. lamoille Lv 1 4 pts. 9,337
  8. Avatar for alwen 18. alwen Lv 1 3 pts. 9,336
  9. Avatar for mimi 19. mimi Lv 1 2 pts. 9,331
  10. Avatar for jamiexq 20. jamiexq Lv 1 2 pts. 9,330

Comments