Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 9,751
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,664
  3. Avatar for xkcd 13. xkcd 2 pts. 9,550
  4. Avatar for Minions of TWIS 14. Minions of TWIS 2 pts. 9,452
  5. Avatar for freefolder 15. freefolder 1 pt. 9,327
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,226
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,203
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  9. Avatar for Deleted group 19. Deleted group pts. 9,102
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,076

  1. Avatar for tarimo 61. tarimo Lv 1 23 pts. 9,769
  2. Avatar for deLaCeiba 62. deLaCeiba Lv 1 23 pts. 9,766
  3. Avatar for TomTaylor 63. TomTaylor Lv 1 22 pts. 9,752
  4. Avatar for kitek314_pl 64. kitek314_pl Lv 1 21 pts. 9,751
  5. Avatar for gurch 65. gurch Lv 1 21 pts. 9,750
  6. Avatar for Marvelz 66. Marvelz Lv 1 20 pts. 9,733
  7. Avatar for Greenlee 67. Greenlee Lv 1 20 pts. 9,728
  8. Avatar for JUMELLE54 68. JUMELLE54 Lv 1 19 pts. 9,727
  9. Avatar for stomjoh 69. stomjoh Lv 1 18 pts. 9,722
  10. Avatar for Deleted player 70. Deleted player pts. 9,702

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?