Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,013
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 10,012
  3. Avatar for reefyrob 3. reefyrob Lv 1 73 pts. 10,012
  4. Avatar for Deleted player 4. Deleted player pts. 10,001
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 52 pts. 10,001
  6. Avatar for bertro 6. bertro Lv 1 43 pts. 9,992
  7. Avatar for Galaxie 7. Galaxie Lv 1 36 pts. 9,990
  8. Avatar for MaartenDesnouck 8. MaartenDesnouck Lv 1 30 pts. 9,989
  9. Avatar for phi16 9. phi16 Lv 1 24 pts. 9,988
  10. Avatar for gmn 10. gmn Lv 1 20 pts. 9,985

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?