Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485

  1. Avatar for Festering Wounds 91. Festering Wounds Lv 1 9 pts. 9,641
  2. Avatar for eusair 92. eusair Lv 1 9 pts. 9,640
  3. Avatar for Soggy Doglog 93. Soggy Doglog Lv 1 9 pts. 9,626
  4. Avatar for NameChangeNeeded01 94. NameChangeNeeded01 Lv 1 8 pts. 9,625
  5. Avatar for sheerbliss 95. sheerbliss Lv 1 8 pts. 9,612
  6. Avatar for ppp6 96. ppp6 Lv 1 8 pts. 9,585
  7. Avatar for greepski 97. greepski Lv 1 8 pts. 9,579
  8. Avatar for t012 98. t012 Lv 1 7 pts. 9,560
  9. Avatar for manu8170 99. manu8170 Lv 1 7 pts. 9,560
  10. Avatar for harvardman 100. harvardman Lv 1 7 pts. 9,559

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?