Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485

  1. Avatar for hada 121. hada Lv 1 3 pts. 9,453
  2. Avatar for gldisater 122. gldisater Lv 1 3 pts. 9,452
  3. Avatar for rtkitters 123. rtkitters Lv 1 3 pts. 9,441
  4. Avatar for alwen 124. alwen Lv 1 3 pts. 9,440
  5. Avatar for TheStaticSloth 125. TheStaticSloth Lv 1 3 pts. 9,435
  6. Avatar for bzipitidoo 126. bzipitidoo Lv 1 3 pts. 9,435
  7. Avatar for Dantoto 127. Dantoto Lv 1 3 pts. 9,433
  8. Avatar for navn 128. navn Lv 1 2 pts. 9,428
  9. Avatar for Punktchen 129. Punktchen Lv 1 2 pts. 9,428
  10. Avatar for ratqueen03 130. ratqueen03 Lv 1 2 pts. 9,425

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?