Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485
  1. Avatar for Fokin Bogdan 161. Fokin Bogdan Lv 1 1 pt. 9,220
  2. Avatar for Iron pet 162. Iron pet Lv 1 1 pt. 9,212
  3. Avatar for jbmkfm125 163. jbmkfm125 Lv 1 1 pt. 9,211
  4. Avatar for Andi1960 164. Andi1960 Lv 1 1 pt. 9,207
  5. Avatar for bcd 165. bcd Lv 1 1 pt. 9,206
  6. Avatar for Savas 166. Savas Lv 1 1 pt. 9,203
  7. Avatar for brendanw 167. brendanw Lv 1 1 pt. 9,201
  8. Avatar for lamoille 168. lamoille Lv 1 1 pt. 9,196
  9. Avatar for nagistick 169. nagistick Lv 1 1 pt. 9,181
  10. Avatar for GreekCivilization 170. GreekCivilization Lv 1 1 pt. 9,180

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?