Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485
  1. Avatar for Thebatman012 201. Thebatman012 Lv 1 1 pt. 9,041
  2. Avatar for Tyrone Shoelaces 202. Tyrone Shoelaces Lv 1 1 pt. 9,039
  3. Avatar for jovanyfranco 203. jovanyfranco Lv 1 1 pt. 9,038
  4. Avatar for Inkedhands 204. Inkedhands Lv 1 1 pt. 9,037
  5. Avatar for crackenmeister 205. crackenmeister Lv 1 1 pt. 9,031
  6. Avatar for JackONeill12 206. JackONeill12 Lv 1 1 pt. 9,028
  7. Avatar for georg137 207. georg137 Lv 1 1 pt. 9,028
  8. Avatar for pllq 208. pllq Lv 1 1 pt. 9,006
  9. Avatar for sensimilla 209. sensimilla Lv 1 1 pt. 9,002
  10. Avatar for gs8577 210. gs8577 Lv 1 1 pt. 8,954

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?