Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485
  1. Avatar for crpainter 71. crpainter Lv 1 17 pts. 9,702
  2. Avatar for isaksson 72. isaksson Lv 1 17 pts. 9,697
  3. Avatar for ManVsYard 73. ManVsYard Lv 1 16 pts. 9,690
  4. Avatar for froggs554 74. froggs554 Lv 1 16 pts. 9,686
  5. Avatar for fiendish_ghoul 75. fiendish_ghoul Lv 1 15 pts. 9,681
  6. Avatar for Mohambone 76. Mohambone Lv 1 15 pts. 9,676
  7. Avatar for caglar 77. caglar Lv 1 15 pts. 9,675
  8. Avatar for pfirth 78. pfirth Lv 1 14 pts. 9,668
  9. Avatar for TJOK fan 79. TJOK fan Lv 1 14 pts. 9,667
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 13 pts. 9,664

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?