Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485
  1. Avatar for Colostomy EXPLOSION. 81. Colostomy EXPLOSION. Lv 1 13 pts. 9,658
  2. Avatar for Ernst Zundel 82. Ernst Zundel Lv 1 12 pts. 9,657
  3. Avatar for PrettyPony2001 83. PrettyPony2001 Lv 1 12 pts. 9,657
  4. Avatar for uihcv 84. uihcv Lv 1 12 pts. 9,657
  5. Avatar for ecali 85. ecali Lv 1 11 pts. 9,651
  6. Avatar for Truncheon Luncheon 86. Truncheon Luncheon Lv 1 11 pts. 9,650
  7. Avatar for jobo0502 87. jobo0502 Lv 1 11 pts. 9,648
  8. Avatar for Vinara 88. Vinara Lv 1 10 pts. 9,646
  9. Avatar for Mydogisa Toelicker 89. Mydogisa Toelicker Lv 1 10 pts. 9,646
  10. Avatar for Pro Lapser 90. Pro Lapser Lv 1 10 pts. 9,645

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?