Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,013
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,990
  3. Avatar for Void Crushers 3. Void Crushers 63 pts. 9,967
  4. Avatar for Contenders 4. Contenders 49 pts. 9,933
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,928
  6. Avatar for Go Science 6. Go Science 28 pts. 9,921
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 9,886
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,869
  9. Avatar for Deleted group 9. Deleted group pts. 9,816
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,766

  1. Avatar for hada 121. hada Lv 1 3 pts. 9,453
  2. Avatar for gldisater 122. gldisater Lv 1 3 pts. 9,452
  3. Avatar for rtkitters 123. rtkitters Lv 1 3 pts. 9,441
  4. Avatar for alwen 124. alwen Lv 1 3 pts. 9,440
  5. Avatar for TheStaticSloth 125. TheStaticSloth Lv 1 3 pts. 9,435
  6. Avatar for bzipitidoo 126. bzipitidoo Lv 1 3 pts. 9,435
  7. Avatar for Dantoto 127. Dantoto Lv 1 3 pts. 9,433
  8. Avatar for navn 128. navn Lv 1 2 pts. 9,428
  9. Avatar for Punktchen 129. Punktchen Lv 1 2 pts. 9,428
  10. Avatar for ratqueen03 130. ratqueen03 Lv 1 2 pts. 9,425

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?