Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 9,448
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 98 pts. 9,423
  3. Avatar for Deleted player 3. Deleted player pts. 9,419
  4. Avatar for MattTheGeek 4. MattTheGeek Lv 1 94 pts. 9,417
  5. Avatar for KarenCH 5. KarenCH Lv 1 92 pts. 9,416
  6. Avatar for Galaxie 6. Galaxie Lv 1 90 pts. 9,411
  7. Avatar for bertro 7. bertro Lv 1 88 pts. 9,402
  8. Avatar for Scopper 8. Scopper Lv 1 86 pts. 9,401
  9. Avatar for Susume 9. Susume Lv 1 84 pts. 9,391
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 82 pts. 9,378

Comments