Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,452
  2. Avatar for grogar7 2. grogar7 Lv 1 85 pts. 9,450
  3. Avatar for MaartenDesnouck 3. MaartenDesnouck Lv 1 72 pts. 9,448
  4. Avatar for lamoille 4. lamoille Lv 1 61 pts. 9,446
  5. Avatar for alwen 5. alwen Lv 1 51 pts. 9,444
  6. Avatar for jamiexq 6. jamiexq Lv 1 42 pts. 9,443
  7. Avatar for smilingone 7. smilingone Lv 1 35 pts. 9,428
  8. Avatar for LociOiling 8. LociOiling Lv 1 28 pts. 9,425
  9. Avatar for reefyrob 9. reefyrob Lv 1 23 pts. 9,424
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 19 pts. 9,420

Comments