Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,452
  2. Avatar for grogar7 2. grogar7 Lv 1 85 pts. 9,450
  3. Avatar for MaartenDesnouck 3. MaartenDesnouck Lv 1 72 pts. 9,448
  4. Avatar for lamoille 4. lamoille Lv 1 61 pts. 9,446
  5. Avatar for alwen 5. alwen Lv 1 51 pts. 9,444
  6. Avatar for jamiexq 6. jamiexq Lv 1 42 pts. 9,443
  7. Avatar for smilingone 7. smilingone Lv 1 35 pts. 9,428
  8. Avatar for LociOiling 8. LociOiling Lv 1 28 pts. 9,425
  9. Avatar for reefyrob 9. reefyrob Lv 1 23 pts. 9,424
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 19 pts. 9,420

Comments