Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Deleted group 23. Deleted group pts. 5,622
  2. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452

  1. Avatar for Deleted player 91. Deleted player pts. 8,824
  2. Avatar for SKSbell 92. SKSbell Lv 1 8 pts. 8,818
  3. Avatar for t012 93. t012 Lv 1 8 pts. 8,816
  4. Avatar for senor pit 94. senor pit Lv 1 8 pts. 8,805
  5. Avatar for bcd 95. bcd Lv 1 7 pts. 8,802
  6. Avatar for cbwest 96. cbwest Lv 1 7 pts. 8,801
  7. Avatar for Petrifolder 97. Petrifolder Lv 1 7 pts. 8,793
  8. Avatar for Bushman 98. Bushman Lv 1 7 pts. 8,787
  9. Avatar for Iron pet 99. Iron pet Lv 1 6 pts. 8,767
  10. Avatar for Giant Berk 100. Giant Berk Lv 1 6 pts. 8,761

Comments