Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for ViJay7019 101. ViJay7019 Lv 1 6 pts. 8,751
  2. Avatar for Bautho 102. Bautho Lv 1 6 pts. 8,747
  3. Avatar for boondog 103. boondog Lv 1 5 pts. 8,744
  4. Avatar for manu8170 104. manu8170 Lv 1 5 pts. 8,729
  5. Avatar for Superphosphate 105. Superphosphate Lv 1 5 pts. 8,727
  6. Avatar for arginia 106. arginia Lv 1 5 pts. 8,703
  7. Avatar for Mr_Jolty 107. Mr_Jolty Lv 1 5 pts. 8,685
  8. Avatar for hada 108. hada Lv 1 5 pts. 8,656
  9. Avatar for Merf 109. Merf Lv 1 4 pts. 8,639
  10. Avatar for tela 110. tela Lv 1 4 pts. 8,634

Comments