Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Deleted group 23. Deleted group pts. 5,622
  2. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452

  1. Avatar for Gracier 131. Gracier Lv 1 2 pts. 8,079
  2. Avatar for severin333 132. severin333 Lv 1 2 pts. 8,059
  3. Avatar for lamoille 133. lamoille Lv 1 2 pts. 8,039
  4. Avatar for Arne Heessels 134. Arne Heessels Lv 1 2 pts. 8,020
  5. Avatar for bzipitidoo 135. bzipitidoo Lv 1 2 pts. 8,020
  6. Avatar for lockert 136. lockert Lv 1 2 pts. 8,017
  7. Avatar for SouperGenious 137. SouperGenious Lv 1 2 pts. 8,009
  8. Avatar for Altercomp 138. Altercomp Lv 1 1 pt. 8,000
  9. Avatar for froggs554 139. froggs554 Lv 1 1 pt. 7,998
  10. Avatar for Sydefecks 140. Sydefecks Lv 1 1 pt. 7,939

Comments