Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Deleted group 23. Deleted group pts. 5,622
  2. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452

  1. Avatar for quis 141. quis Lv 1 1 pt. 7,878
  2. Avatar for nagistick 142. nagistick Lv 1 1 pt. 7,758
  3. Avatar for GoodGuyGreg 143. GoodGuyGreg Lv 1 1 pt. 7,754
  4. Avatar for rinze 144. rinze Lv 1 1 pt. 7,735
  5. Avatar for 3rdpage 145. 3rdpage Lv 1 1 pt. 7,723
  6. Avatar for bhodg1 146. bhodg1 Lv 1 1 pt. 7,707
  7. Avatar for chris.owens 147. chris.owens Lv 1 1 pt. 7,695
  8. Avatar for cnhrcolemam 148. cnhrcolemam Lv 1 1 pt. 7,650
  9. Avatar for DScott 149. DScott Lv 1 1 pt. 7,641
  10. Avatar for 01010011111 150. 01010011111 Lv 1 1 pt. 7,586

Comments