Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for citric acid 161. citric acid Lv 1 1 pt. 7,223
  2. Avatar for OnTheHook 162. OnTheHook Lv 1 1 pt. 7,181
  3. Avatar for pllq 163. pllq Lv 1 1 pt. 7,147
  4. Avatar for doctaven 164. doctaven Lv 1 1 pt. 7,146
  5. Avatar for kkkkkk 165. kkkkkk Lv 1 1 pt. 7,137
  6. Avatar for RedDragon88 166. RedDragon88 Lv 1 1 pt. 6,989
  7. Avatar for lulzhex 167. lulzhex Lv 1 1 pt. 6,882
  8. Avatar for larry25427 168. larry25427 Lv 1 1 pt. 6,844
  9. Avatar for MarcoP 169. MarcoP Lv 1 1 pt. 6,796
  10. Avatar for The_Lunar_1 170. The_Lunar_1 Lv 1 1 pt. 6,751

Comments