Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for mastermatt7684 171. mastermatt7684 Lv 1 1 pt. 6,736
  2. Avatar for jebbiek 172. jebbiek Lv 1 1 pt. 6,610
  3. Avatar for pandapharmd 173. pandapharmd Lv 1 1 pt. 6,605
  4. Avatar for Genetickid01 174. Genetickid01 Lv 1 1 pt. 6,596
  5. Avatar for mirjamvandelft 175. mirjamvandelft Lv 1 1 pt. 6,581
  6. Avatar for Ernst Zundel 176. Ernst Zundel Lv 1 1 pt. 6,575
  7. Avatar for Colostomy EXPLOSION. 177. Colostomy EXPLOSION. Lv 1 1 pt. 6,575
  8. Avatar for Mohambone 178. Mohambone Lv 1 1 pt. 6,575
  9. Avatar for Festering Wounds 179. Festering Wounds Lv 1 1 pt. 6,571
  10. Avatar for Truncheon Luncheon 180. Truncheon Luncheon Lv 1 1 pt. 6,566

Comments