Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for reefyrob 11. reefyrob Lv 1 80 pts. 9,375
  2. Avatar for gitwut 12. gitwut Lv 1 78 pts. 9,371
  3. Avatar for actiasluna 13. actiasluna Lv 1 77 pts. 9,366
  4. Avatar for frood66 14. frood66 Lv 1 75 pts. 9,357
  5. Avatar for tarimo 15. tarimo Lv 1 73 pts. 9,352
  6. Avatar for justjustin 16. justjustin Lv 1 71 pts. 9,342
  7. Avatar for O Seki To 17. O Seki To Lv 1 70 pts. 9,340
  8. Avatar for phi16 18. phi16 Lv 1 68 pts. 9,332
  9. Avatar for Qfast 19. Qfast Lv 1 67 pts. 9,327
  10. Avatar for pauldunn 20. pauldunn Lv 1 65 pts. 9,326

Comments