Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for aspadistra 211. aspadistra Lv 1 1 pt. 5,452
  2. Avatar for NotJim99 212. NotJim99 Lv 1 1 pt. 5,441
  3. Avatar for sumanthratna 213. sumanthratna Lv 1 1 pt. 5,432
  4. Avatar for Close At Hand 214. Close At Hand Lv 1 1 pt. 5,417
  5. Avatar for jeffjamebart 215. jeffjamebart Lv 1 1 pt. 5,337
  6. Avatar for MaartenDesnouck 216. MaartenDesnouck Lv 1 1 pt. 4,918
  7. Avatar for Snowkit 217. Snowkit Lv 1 1 pt. 4,725
  8. Avatar for matttmo 218. matttmo Lv 1 1 pt. 3,788
  9. Avatar for NicoleOwls 219. NicoleOwls Lv 1 1 pt. 3,645
  10. Avatar for nunux17 220. nunux17 Lv 1 1 pt. 0

Comments