Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Deleted group 23. Deleted group pts. 5,622
  2. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452

  1. Avatar for katiekt94 221. katiekt94 Lv 1 1 pt. 0
  2. Avatar for packer 222. packer Lv 1 1 pt. 0
  3. Avatar for wyattj 223. wyattj Lv 1 1 pt. 0
  4. Avatar for JackONeill12 224. JackONeill12 Lv 1 1 pt. 0
  5. Avatar for erik strand 225. erik strand Lv 1 1 pt. 0
  6. Avatar for puxatudo 227. puxatudo Lv 1 1 pt. 0

Comments