Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for bendbob 21. bendbob Lv 1 63 pts. 9,323
  2. Avatar for mimi 22. mimi Lv 1 62 pts. 9,321
  3. Avatar for Mark- 23. Mark- Lv 1 60 pts. 9,321
  4. Avatar for andrewxc 24. andrewxc Lv 1 59 pts. 9,318
  5. Avatar for jamiexq 25. jamiexq Lv 1 58 pts. 9,315
  6. Avatar for nemo7731 26. nemo7731 Lv 1 56 pts. 9,315
  7. Avatar for nicobul 27. nicobul Lv 1 55 pts. 9,310
  8. Avatar for isaksson 28. isaksson Lv 1 53 pts. 9,307
  9. Avatar for Blipperman 29. Blipperman Lv 1 52 pts. 9,305
  10. Avatar for LociOiling 30. LociOiling Lv 1 51 pts. 9,299

Comments