Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for diamonddays 61. diamonddays Lv 1 22 pts. 9,091
  2. Avatar for alwen 62. alwen Lv 1 21 pts. 9,091
  3. Avatar for Mike Lewis 63. Mike Lewis Lv 1 21 pts. 9,087
  4. Avatar for weitzen 64. weitzen Lv 1 20 pts. 9,072
  5. Avatar for ecali 65. ecali Lv 1 19 pts. 9,065
  6. Avatar for hansvandenhof 66. hansvandenhof Lv 1 19 pts. 9,053
  7. Avatar for temandocorreo 67. temandocorreo Lv 1 18 pts. 9,023
  8. Avatar for Glen B 68. Glen B Lv 1 18 pts. 9,011
  9. Avatar for Satina 69. Satina Lv 1 17 pts. 9,000
  10. Avatar for BCAA 70. BCAA Lv 1 17 pts. 8,996

Comments