Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for TomTaylor 71. TomTaylor Lv 1 16 pts. 8,990
  2. Avatar for smilingone 72. smilingone Lv 1 16 pts. 8,981
  3. Avatar for YGK 73. YGK Lv 1 15 pts. 8,973
  4. Avatar for deLaCeiba 74. deLaCeiba Lv 1 15 pts. 8,968
  5. Avatar for Rav3n_pl 75. Rav3n_pl Lv 1 14 pts. 8,964
  6. Avatar for snakeguy 76. snakeguy Lv 1 14 pts. 8,963
  7. Avatar for fishercat 77. fishercat Lv 1 13 pts. 8,937
  8. Avatar for Vinara 78. Vinara Lv 1 13 pts. 8,934
  9. Avatar for Schleicher 79. Schleicher Lv 1 13 pts. 8,921
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 12 pts. 8,918

Comments