Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for Deleted player 11. Deleted player pts. 9,417
  2. Avatar for pauldunn 12. pauldunn Lv 1 12 pts. 9,400
  3. Avatar for penteplayer 13. penteplayer Lv 1 9 pts. 9,399
  4. Avatar for gloverd 14. gloverd Lv 1 7 pts. 9,399
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 5 pts. 9,384
  6. Avatar for ManVsYard 16. ManVsYard Lv 1 4 pts. 9,382
  7. Avatar for actiasluna 17. actiasluna Lv 1 3 pts. 9,381
  8. Avatar for Blipperman 18. Blipperman Lv 1 2 pts. 9,379
  9. Avatar for Skippysk8s 19. Skippysk8s Lv 1 2 pts. 9,374
  10. Avatar for dbuske 20. dbuske Lv 1 1 pt. 9,371

Comments