Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for mimi 21. mimi Lv 1 1 pt. 9,366
  2. Avatar for gitwut 22. gitwut Lv 1 1 pt. 9,353
  3. Avatar for sheerbliss 23. sheerbliss Lv 1 1 pt. 9,348
  4. Avatar for O Seki To 24. O Seki To Lv 1 1 pt. 9,342
  5. Avatar for phi16 25. phi16 Lv 1 1 pt. 9,314
  6. Avatar for jermainiac 26. jermainiac Lv 1 1 pt. 9,279
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 1 pt. 9,187
  8. Avatar for Bautho 28. Bautho Lv 1 1 pt. 9,163
  9. Avatar for ViJay7019 29. ViJay7019 Lv 1 1 pt. 9,162
  10. Avatar for nemo7731 30. nemo7731 Lv 1 1 pt. 9,117

Comments