Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for ViJay7019 101. ViJay7019 Lv 1 6 pts. 8,751
  2. Avatar for Bautho 102. Bautho Lv 1 6 pts. 8,747
  3. Avatar for boondog 103. boondog Lv 1 5 pts. 8,744
  4. Avatar for manu8170 104. manu8170 Lv 1 5 pts. 8,729
  5. Avatar for Superphosphate 105. Superphosphate Lv 1 5 pts. 8,727
  6. Avatar for arginia 106. arginia Lv 1 5 pts. 8,703
  7. Avatar for Mr_Jolty 107. Mr_Jolty Lv 1 5 pts. 8,685
  8. Avatar for hada 108. hada Lv 1 5 pts. 8,656
  9. Avatar for Merf 109. Merf Lv 1 4 pts. 8,639
  10. Avatar for tela 110. tela Lv 1 4 pts. 8,634

Comments