Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for citric acid 161. citric acid Lv 1 1 pt. 7,223
  2. Avatar for OnTheHook 162. OnTheHook Lv 1 1 pt. 7,181
  3. Avatar for pllq 163. pllq Lv 1 1 pt. 7,147
  4. Avatar for doctaven 164. doctaven Lv 1 1 pt. 7,146
  5. Avatar for kkkkkk 165. kkkkkk Lv 1 1 pt. 7,137
  6. Avatar for RedDragon88 166. RedDragon88 Lv 1 1 pt. 6,989
  7. Avatar for lulzhex 167. lulzhex Lv 1 1 pt. 6,882
  8. Avatar for larry25427 168. larry25427 Lv 1 1 pt. 6,844
  9. Avatar for MarcoP 169. MarcoP Lv 1 1 pt. 6,796
  10. Avatar for The_Lunar_1 170. The_Lunar_1 Lv 1 1 pt. 6,751

Comments