Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for mastermatt7684 171. mastermatt7684 Lv 1 1 pt. 6,736
  2. Avatar for jebbiek 172. jebbiek Lv 1 1 pt. 6,610
  3. Avatar for pandapharmd 173. pandapharmd Lv 1 1 pt. 6,605
  4. Avatar for Genetickid01 174. Genetickid01 Lv 1 1 pt. 6,596
  5. Avatar for mirjamvandelft 175. mirjamvandelft Lv 1 1 pt. 6,581
  6. Avatar for Ernst Zundel 176. Ernst Zundel Lv 1 1 pt. 6,575
  7. Avatar for Mohambone 178. Mohambone Lv 1 1 pt. 6,575
  8. Avatar for Festering Wounds 179. Festering Wounds Lv 1 1 pt. 6,571
  9. Avatar for Truncheon Luncheon 180. Truncheon Luncheon Lv 1 1 pt. 6,566

Comments