Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for reefyrob 11. reefyrob Lv 1 80 pts. 9,375
  2. Avatar for gitwut 12. gitwut Lv 1 78 pts. 9,371
  3. Avatar for actiasluna 13. actiasluna Lv 1 77 pts. 9,366
  4. Avatar for frood66 14. frood66 Lv 1 75 pts. 9,357
  5. Avatar for tarimo 15. tarimo Lv 1 73 pts. 9,352
  6. Avatar for justjustin 16. justjustin Lv 1 71 pts. 9,342
  7. Avatar for O Seki To 17. O Seki To Lv 1 70 pts. 9,340
  8. Avatar for phi16 18. phi16 Lv 1 68 pts. 9,332
  9. Avatar for Qfast 19. Qfast Lv 1 67 pts. 9,327
  10. Avatar for pauldunn 20. pauldunn Lv 1 65 pts. 9,326

Comments