Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for diamonddays 61. diamonddays Lv 1 22 pts. 9,091
  2. Avatar for alwen 62. alwen Lv 1 21 pts. 9,091
  3. Avatar for Mike Lewis 63. Mike Lewis Lv 1 21 pts. 9,087
  4. Avatar for weitzen 64. weitzen Lv 1 20 pts. 9,072
  5. Avatar for ecali 65. ecali Lv 1 19 pts. 9,065
  6. Avatar for hansvandenhof 66. hansvandenhof Lv 1 19 pts. 9,053
  7. Avatar for temandocorreo 67. temandocorreo Lv 1 18 pts. 9,023
  8. Avatar for Glen B 68. Glen B Lv 1 18 pts. 9,011
  9. Avatar for Satina 69. Satina Lv 1 17 pts. 9,000
  10. Avatar for BCAA 70. BCAA Lv 1 17 pts. 8,996

Comments