Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266

  1. Avatar for TomTaylor 71. TomTaylor Lv 1 16 pts. 8,990
  2. Avatar for smilingone 72. smilingone Lv 1 16 pts. 8,981
  3. Avatar for YGK 73. YGK Lv 1 15 pts. 8,973
  4. Avatar for deLaCeiba 74. deLaCeiba Lv 1 15 pts. 8,968
  5. Avatar for Rav3n_pl 75. Rav3n_pl Lv 1 14 pts. 8,964
  6. Avatar for snakeguy 76. snakeguy Lv 1 14 pts. 8,963
  7. Avatar for fishercat 77. fishercat Lv 1 13 pts. 8,937
  8. Avatar for Vinara 78. Vinara Lv 1 13 pts. 8,934
  9. Avatar for Schleicher 79. Schleicher Lv 1 13 pts. 8,921
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 12 pts. 8,918

Comments