Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  8. Avatar for Deleted group 19. Deleted group pts. 6,700
  9. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,196
  2. Avatar for phi16 2. phi16 Lv 1 87 pts. 9,189
  3. Avatar for gitwut 3. gitwut Lv 1 76 pts. 9,187
  4. Avatar for lamoille 4. lamoille Lv 1 65 pts. 9,187
  5. Avatar for MaartenDesnouck 5. MaartenDesnouck Lv 1 56 pts. 9,183
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 48 pts. 9,182
  7. Avatar for alwen 7. alwen Lv 1 41 pts. 9,181
  8. Avatar for gmn 8. gmn Lv 1 34 pts. 9,181
  9. Avatar for LociOiling 9. LociOiling Lv 1 29 pts. 9,158
  10. Avatar for smilingone 10. smilingone Lv 1 24 pts. 9,156

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.