Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  8. Avatar for Deleted group 19. Deleted group pts. 6,700
  9. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377

  1. Avatar for pocahy 161. pocahy Lv 1 1 pt. 7,644
  2. Avatar for TheStaticSloth 162. TheStaticSloth Lv 1 1 pt. 7,615
  3. Avatar for sean4046 163. sean4046 Lv 1 1 pt. 7,608
  4. Avatar for viniciussm 164. viniciussm Lv 1 1 pt. 7,604
  5. Avatar for DScott 166. DScott Lv 1 1 pt. 7,533
  6. Avatar for Tac1 167. Tac1 Lv 1 1 pt. 7,515
  7. Avatar for pandapharmd 168. pandapharmd Lv 1 1 pt. 7,515
  8. Avatar for Close At Hand 169. Close At Hand Lv 1 1 pt. 7,462
  9. Avatar for Wheeler22 170. Wheeler22 Lv 1 1 pt. 7,408

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.