Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Chem251-601 Spring 2016 17. Chem251-601 Spring 2016 1 pt. 7,558
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  9. Avatar for Deleted group 19. Deleted group pts. 6,700
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377
  1. Avatar for Inkedhands 171. Inkedhands Lv 1 1 pt. 7,371
  2. Avatar for Jaco van As 172. Jaco van As Lv 1 1 pt. 7,339
  3. Avatar for chris.owens 173. chris.owens Lv 1 1 pt. 7,333
  4. Avatar for lucky13.06 174. lucky13.06 Lv 1 1 pt. 7,281
  5. Avatar for cnhrcolemam 175. cnhrcolemam Lv 1 1 pt. 7,264
  6. Avatar for Albatross795 176. Albatross795 Lv 1 1 pt. 7,251
  7. Avatar for otong1 177. otong1 Lv 1 1 pt. 7,224
  8. Avatar for Sydefecks 178. Sydefecks Lv 1 1 pt. 7,216
  9. Avatar for yaoye 179. yaoye Lv 1 1 pt. 7,204
  10. Avatar for Blitzghost 180. Blitzghost Lv 1 1 pt. 7,188

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.