Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  8. Avatar for Deleted group 19. Deleted group pts. 6,700
  9. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377

  1. Avatar for Pro Lapser 181. Pro Lapser Lv 1 1 pt. 7,158
  2. Avatar for maria_pl 182. maria_pl Lv 1 1 pt. 7,131
  3. Avatar for tela 183. tela Lv 1 1 pt. 7,086
  4. Avatar for DennisM1301 184. DennisM1301 Lv 1 1 pt. 7,053
  5. Avatar for isantheautumn 185. isantheautumn Lv 1 1 pt. 7,046
  6. Avatar for PrettyPony2001 186. PrettyPony2001 Lv 1 1 pt. 6,972
  7. Avatar for Mydogisa Toelicker 188. Mydogisa Toelicker Lv 1 1 pt. 6,967
  8. Avatar for Soggy Doglog 189. Soggy Doglog Lv 1 1 pt. 6,967
  9. Avatar for NameChangeNeeded01 190. NameChangeNeeded01 Lv 1 1 pt. 6,967

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.