Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  8. Avatar for Deleted group 19. Deleted group pts. 6,700
  9. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377

  1. Avatar for steising 221. steising Lv 1 1 pt. 6,108
  2. Avatar for kwak 222. kwak Lv 1 1 pt. 6,099
  3. Avatar for vanohaker 223. vanohaker Lv 1 1 pt. 6,096
  4. Avatar for henriqkz 224. henriqkz Lv 1 1 pt. 6,095
  5. Avatar for PISKOR 225. PISKOR Lv 1 1 pt. 6,078
  6. Avatar for FelipeSMA 226. FelipeSMA Lv 1 1 pt. 6,008
  7. Avatar for Kajmo 227. Kajmo Lv 1 1 pt. 5,996
  8. Avatar for crozacx 228. crozacx Lv 1 1 pt. 5,787
  9. Avatar for Yvan Xu 229. Yvan Xu Lv 1 1 pt. 5,624
  10. Avatar for lamoille 230. lamoille Lv 1 1 pt. 5,623

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.