Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 8,881
  2. Avatar for xkcd 12. xkcd 4 pts. 8,726
  3. Avatar for It's over 9000! 13. It's over 9000! 2 pts. 8,691
  4. Avatar for Russian team 14. Russian team 2 pts. 8,543
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,455
  6. Avatar for Deleted group 16. Deleted group pts. 7,658
  7. Avatar for Chem251-601 Spring 2016 17. Chem251-601 Spring 2016 1 pt. 7,558
  8. Avatar for Rechenkraft.net 18. Rechenkraft.net 1 pt. 6,762
  9. Avatar for Deleted group 19. Deleted group pts. 6,700
  10. Avatar for Natural Abilities 20. Natural Abilities 1 pt. 6,377
  1. Avatar for WarpSpeed 81. WarpSpeed Lv 1 14 pts. 8,787
  2. Avatar for caglar 82. caglar Lv 1 14 pts. 8,773
  3. Avatar for cbwest 83. cbwest Lv 1 13 pts. 8,762
  4. Avatar for manu8170 84. manu8170 Lv 1 13 pts. 8,759
  5. Avatar for mrmookie 85. mrmookie Lv 1 12 pts. 8,759
  6. Avatar for alwen 86. alwen Lv 1 12 pts. 8,744
  7. Avatar for smholst 87. smholst Lv 1 12 pts. 8,744
  8. Avatar for dizzywings 88. dizzywings Lv 1 11 pts. 8,743
  9. Avatar for tallguy-13088 89. tallguy-13088 Lv 1 11 pts. 8,740
  10. Avatar for Deleted player 90. Deleted player pts. 8,729

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.