Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 6,232
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 5,544
  3. Avatar for Window Group 23. Window Group 1 pt. 0
  1. Avatar for gitwut
    1. gitwut Lv 1
    100 pts. 9,190
  2. Avatar for bendbob 2. bendbob Lv 1 98 pts. 9,184
  3. Avatar for spvincent 3. spvincent Lv 1 96 pts. 9,174
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 94 pts. 9,174
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 93 pts. 9,141
  6. Avatar for matosfran 6. matosfran Lv 1 91 pts. 9,140
  7. Avatar for actiasluna 7. actiasluna Lv 1 89 pts. 9,134
  8. Avatar for Susume 8. Susume Lv 1 87 pts. 9,131
  9. Avatar for Galaxie 9. Galaxie Lv 1 85 pts. 9,126
  10. Avatar for johnmitch 10. johnmitch Lv 1 83 pts. 9,118

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.