Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,196
  2. Avatar for Contenders 2. Contenders 80 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,158
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,137
  5. Avatar for Bad Monkey 5. Bad Monkey 37 pts. 9,113
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,098
  7. Avatar for Go Science 7. Go Science 21 pts. 9,094
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,018
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,001
  10. Avatar for Deleted group 10. Deleted group pts. 8,918
  1. Avatar for mirp 21. mirp Lv 1 2 pts. 9,093
  2. Avatar for gloverd 22. gloverd Lv 1 2 pts. 9,092
  3. Avatar for penteplayer 23. penteplayer Lv 1 1 pt. 9,080
  4. Avatar for pauldunn 24. pauldunn Lv 1 1 pt. 9,079
  5. Avatar for Scopper 25. Scopper Lv 1 1 pt. 9,076
  6. Avatar for maria_pl 26. maria_pl Lv 1 1 pt. 9,060
  7. Avatar for bertro 27. bertro Lv 1 1 pt. 9,046
  8. Avatar for ManVsYard 28. ManVsYard Lv 1 1 pt. 9,041
  9. Avatar for TomTaylor 29. TomTaylor Lv 1 1 pt. 9,040
  10. Avatar for ViJay7019 30. ViJay7019 Lv 1 1 pt. 9,037

Comments

Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.