Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,196
  2. Avatar for Contenders 2. Contenders 80 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,158
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,137
  5. Avatar for Bad Monkey 5. Bad Monkey 37 pts. 9,113
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,098
  7. Avatar for Go Science 7. Go Science 21 pts. 9,094
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,018
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,001
  10. Avatar for Deleted group 10. Deleted group pts. 8,918

  1. Avatar for mitarcher 121. mitarcher Lv 1 4 pts. 8,439
  2. Avatar for arginia 122. arginia Lv 1 4 pts. 8,388
  3. Avatar for Hollinas 123. Hollinas Lv 1 3 pts. 8,387
  4. Avatar for darioarena 124. darioarena Lv 1 3 pts. 8,386
  5. Avatar for pfirth 125. pfirth Lv 1 3 pts. 8,375
  6. Avatar for fmtzhangli 126. fmtzhangli Lv 1 3 pts. 8,339
  7. Avatar for senor pit 127. senor pit Lv 1 3 pts. 8,316
  8. Avatar for dbuske 128. dbuske Lv 1 3 pts. 8,312
  9. Avatar for severin333 129. severin333 Lv 1 3 pts. 8,310
  10. Avatar for BackBuffer 130. BackBuffer Lv 1 3 pts. 8,292

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.