Placeholder image of a protein
Icon representing a puzzle

1209: Unsolved De-novo Freestyle 74

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRDPNSIVEIRIGPDGVEIEFLGDDSLLRIHVPRDYTEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,196
  2. Avatar for Contenders 2. Contenders 80 pts. 9,190
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,158
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 9,137
  5. Avatar for Bad Monkey 5. Bad Monkey 37 pts. 9,113
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,098
  7. Avatar for Go Science 7. Go Science 21 pts. 9,094
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 15 pts. 9,018
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,001
  10. Avatar for Deleted group 10. Deleted group pts. 8,918

  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 32 pts. 8,933
  2. Avatar for Vinara 52. Vinara Lv 1 31 pts. 8,920
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 30 pts. 8,918
  4. Avatar for Threeoak 54. Threeoak Lv 1 30 pts. 8,917
  5. Avatar for stomjoh 55. stomjoh Lv 1 29 pts. 8,910
  6. Avatar for jamiexq 56. jamiexq Lv 1 28 pts. 8,908
  7. Avatar for smilingone 57. smilingone Lv 1 27 pts. 8,904
  8. Avatar for Rav3n_pl 58. Rav3n_pl Lv 1 27 pts. 8,903
  9. Avatar for joremen 59. joremen Lv 1 26 pts. 8,886
  10. Avatar for Marvelz 60. Marvelz Lv 1 25 pts. 8,883

Comments


Bletchley Park Lv 1

Why doesn't this puzzle have a Rama Map available ? It would be an interesting test to see if we can come up with better loop connections if we had visual feedback on this one.

bkoep Staff Lv 1

I wouldn't recommend drawing too heavily on the "Ideal Loops" for structure prediction puzzles. But if players find the Rama Map generally useful, we could enable it on more types of puzzles.